PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G094600.1
Common NamePHAVU_003G094600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 301aa    MW: 34328.1 Da    PI: 6.8531
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G094600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.3e-172471148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W+ eEd ll+++++ +G g+W++ a   g++Rt+k+c++rw++yl
  Phvul.003G094600.1 24 RGSWSVEEDNLLINYIANHGEGRWNLLAISSGLRRTGKSCRLRWLNYL 71
                        89********************************************97 PP

2Myb_DNA-binding49.88e-1677120146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+ T eE++l+ +++ ++G++ W++Ia+ ++ gRt++++k++w++
  Phvul.003G094600.1  77 RGNLTSEEQLLIFELHSKWGNR-WSKIAQQLP-GRTDNEIKNYWRT 120
                         7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1321971IPR017930Myb domain
SuperFamilySSF466898.24E-2922118IPR009057Homeodomain-like
SMARTSM007173.4E-142373IPR001005SANT/Myb domain
PfamPF002491.7E-152471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-222578IPR009057Homeodomain-like
CDDcd001679.03E-112671No hitNo description
PROSITE profilePS5129424.97872126IPR017930Myb domain
SMARTSM007177.5E-1476124IPR001005SANT/Myb domain
PfamPF002493.2E-1477120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2279125IPR009057Homeodomain-like
CDDcd001676.28E-1181120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MRLAMSTPSK SIICYSEEDN ELRRGSWSVE EDNLLINYIA NHGEGRWNLL AISSGLRRTG  60
KSCRLRWLNY LKPDIKRGNL TSEEQLLIFE LHSKWGNRWS KIAQQLPGRT DNEIKNYWRT  120
RIQKQARYVK FETQRTTRFL EFVKGLQTTR YLLKAQESSP SAKSLQDQEI PLPSDGGSHY  180
SSFGIGATPK TQITCQGGLS HLNQHEQNSD SVHNNGSSIS NSESVNMQNM SQHLGCTTNQ  240
FQALDNYDFG ICSYDCYNLD NNAYDMDSFN LTATVIGCQI SETKWLNMES ECSTRNNDEF  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25211264108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154150.10.0hypothetical protein PHAVU_003G094600g
TrEMBLV7C7Q60.0V7C7Q6_PHAVU; Uncharacterized protein
STRINGGLYMA09G31570.11e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.13e-65myb domain protein 62